<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31157
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MEFFPLNILESLRNRVLQLLHSFTHFLNIIDHSDALPSWKVLISNFNTLLSHVDSISFLLQESDILKETKVFPSSNFPVRQQEGLLTTLLRKKVAPETEEWEAEGRLLGTNAEESTSFYEWAKYIVMQEKEKRNWKGYYTREQELEISQNKTFNQEDTLEEIRKKRKLEETETKAKMNDVLLFMRTGKLEAKS |
Length | 193 |
Position | Head |
Organism | Pneumocystis murina (strain B123) (Mouse pneumocystis pneumonia agent) (Pneumocystis carinii f. sp. muris) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Pneumocystidomycetes> Pneumocystidaceae> Pneumocystis.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.600 |
Instability index | 51.99 |
Isoelectric point | 5.71 |
Molecular weight | 22790.68 |
Publications | PubMed=26899007
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP31157
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.47| 27| 30| 17| 46| 1
---------------------------------------------------------------------------
17- 46 (40.48/37.87) LQLLHSFThFLniIDHSDALPSWKVL.ISNF
50- 77 (42.00/27.04) LSHVDSIS.FL..LQESDILKETKVFpSSNF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.99| 13| 17| 89| 101| 2
---------------------------------------------------------------------------
89- 101 (23.00/15.71) LLRKKVAPETE..EW
107- 121 (17.98/10.82) LLGTNAEESTSfyEW
---------------------------------------------------------------------------
|