<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31147
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MDPKSAPELPPPIEGTYICCGGNYTTDDILPSLEDQGVRQLYPKGPNIAMPPSVLVLIIYFKKELRSLNRELQLHILELADILVERPSQYARSVEDISLIFKNLHHLLNSLCPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRLLKDSIGTMEDTGASFVLK |
Length | 166 |
Position | Middle |
Organism | Prunus persica (Peach) (Amygdalus persica) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.277 |
Instability index | 70.69 |
Isoelectric point | 6.52 |
Molecular weight | 18918.74 |
Publications | PubMed=23525075
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31147
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.76| 11| 41| 84| 97| 1
---------------------------------------------------------------------------
84- 97 (14.48/15.84) VERPSQyarSVEDI
128- 138 (19.28/10.66) IQRRKQ...AVEDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.16| 15| 45| 65| 79| 2
---------------------------------------------------------------------------
65- 79 (26.22/20.01) LRSL....NRELQLHILEL
108- 126 (19.94/13.58) LNSLcphqARATLIHILEL
---------------------------------------------------------------------------
|