<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31140
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASGTESDETADTPPLTNTIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYTKFIMYPHCLFFLEQLQNANFRNAMAHPVNKELAHRQQFYFWKNYRNNRLKHILPRPLPEPVAAPPTPAPPQQPVPPVPATTVSVTANAPAPSPMQYVAPPGSALAKNEARNSGVDRRKRKRMVKN |
Length | 202 |
Position | Middle |
Organism | Prunus persica (Peach) (Amygdalus persica) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.694 |
Instability index | 59.26 |
Isoelectric point | 9.30 |
Molecular weight | 23334.31 |
Publications | PubMed=23525075
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31140
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.00| 15| 27| 139| 153| 1
---------------------------------------------------------------------------
133- 152 (26.56/ 9.73) P....lpepvAAPPTPAPPQQPVP
153- 176 (23.45/ 7.83) PvpattvsvtANAPAPSPMQYVAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.45| 17| 17| 46| 62| 2
---------------------------------------------------------------------------
46- 62 (31.68/15.86) YIHYLAQNRYFEDEAFI
64- 80 (33.77/17.25) YLKYLQYWQRPEYTKFI
---------------------------------------------------------------------------
|