Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASGTESDETADTPPLTNTIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYTKFIMYPHCLFFLEQLQNANFRNAMAHPVNKELAHRQQFYFWKNYRNNRLKHILPRPLPEPVAAPPTPAPPQQPVPPVPATTVSVTANAPAPSPMQYVAPPGSALAKNEARNSGVDRRKRKKEG |
Length | 200 |
Position | Middle |
Organism | Prunus persica (Peach) (Amygdalus persica) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.711 |
Instability index | 58.27 |
Isoelectric point | 9.00 |
Molecular weight | 23019.86 |
Publications | PubMed=23525075 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31127 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.00| 15| 27| 139| 153| 1 --------------------------------------------------------------------------- 133- 152 (26.56/10.47) P....lpepvAAPPTPAPPQQPVP 153- 176 (23.45/ 8.44) PvpattvsvtANAPAPSPMQYVAP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.45| 17| 17| 46| 62| 2 --------------------------------------------------------------------------- 46- 62 (31.68/17.77) YIHYLAQNRYFEDEAFI 64- 80 (33.77/19.31) YLKYLQYWQRPEYTKFI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWKNYRNNRLK 2) PMQYVAPPGSALAKNEARNSGVDRRKRKKE | 117 170 | 127 199 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab