<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31126
| Description |
Uncharacterized protein |
| Sequence | MATPPMAPPSMEGTPPPMAVQPPGTDMTGICFKDQLWLNSYPLDRNLVFDYFAISPFYDWTCNNEQLRQRSIHPLDPSHLSKMTGTEYSLNEVMEPHLFVFRKQKRDGPEKVTPMLTYYVLDGTIYQAPQLCNVFAARIGRALYYISKAFTTAASKLEKIGYVDSENETAAFESKVTKETIDFKEVKRVDHILQSLQRKLPPAPPPPPFPEGYVPAPTAEAENGPETQQAGEPQQPQMDPIIDQGPAKRMKF |
| Length | 252 |
| Position | Head |
| Organism | Prunus persica (Peach) (Amygdalus persica) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.542 |
| Instability index | 55.59 |
| Isoelectric point | 5.47 |
| Molecular weight | 28396.11 |
| Publications | PubMed=23525075
|
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31126
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.19| 16| 17| 144| 159| 1
---------------------------------------------------------------------------
144- 159 (27.02/21.09) YYISKAFTTA.ASKLEK
162- 178 (22.17/16.16) YVDSENETAAfESKVTK
---------------------------------------------------------------------------
|