Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MATTTYPPPPPYYKLYKDYLQDPKSAPELPPEGTYICYGGNYTTDDILPSLEDQGVRQLYPKGPNIAMPPSIPVLIIYFKKELRSLNRELQLHILELADILVERPSQYARSVEDISLIFKNLHDLLNSLRPHQARATLIHILELQIQRRKQAVKDIKRRREEAQRLLKDYIGTLEDTGASFVLK |
Length | 184 |
Position | Middle |
Organism | Prunus persica (Peach) (Amygdalus persica) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.467 |
Instability index | 70.05 |
Isoelectric point | 8.53 |
Molecular weight | 21256.30 |
Publications | PubMed=23525075 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31117 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 64.45| 22| 45| 83| 107| 1 --------------------------------------------------------------------------- 83- 107 (32.65/34.32) LRSL....NRELQLHILELAdilVERPSQ 126- 151 (31.80/23.53) LNSLrphqARATLIHILELQ...IQRRKQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MATTTY 2) PPPYYKLYKDYLQDPK | 1 9 | 6 24 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab