<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31107
Description |
Uncharacterized protein |
Sequence | MAANFWTSSHYKQLFDQEDVDVVFPLDKEKGITLEDFKLIKMHMASYISKLAQHVKVRQRVVATAVTYMRRVYTRKSMSEYDPRLVAPTCLYLASKAEESTVQAKLLVFYIRKIYSDEKYRYEIKDILEMEMKILEALNYYLVVYHPYRSLSQLLQDASLNDISMTQLTWGVVNDTYKMDLALVHPPHLIALACIYIASVLREKDTTAWFEELRVDMNVVKNISMEILDFYENHRMIPEERFNAALNKLAFKP |
Length | 253 |
Position | Kinase |
Organism | Prunus persica (Peach) (Amygdalus persica) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.149 |
Instability index | 40.62 |
Isoelectric point | 6.67 |
Molecular weight | 29763.29 |
Publications | PubMed=23525075
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31107
No repeats found
No repeats found
|