<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31104

Description Uncharacterized protein
SequenceMAPPRGRGGSGGGFRGRGDGGRGGRGGGRFGGGRGGDRGGSAFKSRGGGRGGDRGGRGGRGRGGGMKGGNKVVVEPHRHEGVFIAKGKEDALVTKNMVPGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAILGGVDDIWIKPGARVLYLGAASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARIVALNASYFLKAGGHFVISIKANCIDSTSPAEAVFQQEVKRLQADQFKPMEQVTLEPFERDHACVVGGYRVPKKSKTAA
Length310
PositionUnknown
OrganismPrunus persica (Peach) (Amygdalus persica)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
Aromaticity0.07
Grand average of hydropathy-0.417
Instability index27.98
Isoelectric point10.15
Molecular weight32854.97
Publications
PubMed=23525075

Function

Annotated function
GO - Cellular Component
box C/D RNP complex	GO:0031428	IBA:GO_Central
Cajal body	GO:0015030	IBA:GO_Central
small-subunit processome	GO:0032040	IBA:GO_Central
GO - Biological Function
histone-glutamine methyltransferase activity	GO:1990259	IBA:GO_Central
RNA binding	GO:0003723	IBA:GO_Central
rRNA methyltransferase activity	GO:0008649	IBA:GO_Central
GO - Biological Process
box C/D RNA 3'-end processing	GO:0000494	IBA:GO_Central
histone glutamine methylation	GO:1990258	IBA:GO_Central
rRNA methylation	GO:0031167	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP31104
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.17|      14|      15|      31|      44|       1
---------------------------------------------------------------------------
   31-   44 (29.99/ 9.33)	GGGRGGDRGGSAFK
   47-   60 (32.18/10.52)	GGGRGGDRGGRGGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.03|      17|      17|     191|     207|       3
---------------------------------------------------------------------------
  171-  194 (20.30/11.96)	TGVVYAVEfshrsgrDLVNMAKKR
  195-  211 (30.72/21.28)	TNVIPIIE.......DARHPAKYR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.37|      16|      16|     257|     272|       4
---------------------------------------------------------------------------
  257-  272 (26.45/20.93)	DSTSPAEAVFQQEVKR
  276-  291 (28.93/23.52)	DQFKPMEQVTLEPFER
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31104 with Med36 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MAPPRGRGGSGGGFRGRGDGGRGGRGGGRFGGGRGGDRGGSAFKSRGGGRGGDRGGRGGRGRGGGMKGGNKVVVEPHRHE
1
80

Molecular Recognition Features

MoRF SequenceStartStop
1) MAPPRGRGGSGGGFRGRGDGGRGGRGGGRFGGGRGGDRGGSAFKSRGGGRGGDRGGRGGRGR
1
62