<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31097
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MSNLSPYPPAIHSPFPASAPQTPGASSADDSSDSEPDASAPFTPFTPYTPGPDGPGVNSPGRSPTTPREFLGLKGSERRRPEGTLGHVELLLEALAEELNTLQTRAEAVYAPRREEDGPLIHATVREVVDKLQQLEEAAPGLDEWVPIQVLEYLDEGRNPDDYTRTMLELTAAENQFTNGKVHAVHSYLQLLSAGIAEAFPDMAEFVPPPQIPLDDMPSAQDEGGMSGQEKSKEVREVPIVVIDEAPKVEDSAAPKGEQAVPGIPVDASQDLGGHIDVGIEEPLAPAAPTAGQ |
| Length | 293 |
| Position | Middle |
| Organism | Dacryopinax primogenitus (strain DJM 731) (Brown rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Dacrymycetes>
Dacrymycetales> Dacrymycetaceae> Dacryopinax.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.488 |
| Instability index | 61.06 |
| Isoelectric point | 4.29 |
| Molecular weight | 31158.08 |
| Publications | PubMed=22745431
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31097
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.27| 16| 20| 33| 51| 1
---------------------------------------------------------------------------
9- 24 (31.94/ 9.45) PAIHSPFPASAPQTPG
36- 51 (33.32/16.48) PDASAPFTPFTPYTPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.82| 20| 20| 121| 140| 2
---------------------------------------------------------------------------
66- 81 (21.33/10.16) ........TPREFLG.LKGSERR..RP
86- 112 (19.35/ 8.62) GHVellleALAEELNTLQTRAEAvyAP
121- 140 (32.14/18.57) IHA.....TVREVVDKLQQLEEA..AP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.82| 21| 51| 199| 225| 3
---------------------------------------------------------------------------
199- 224 (29.30/25.11) AFPDMAEFVppPQIPLDdmpSAQDEG
253- 273 (36.52/15.26) AAPKGEQAV..PGIPVD...ASQDLG
---------------------------------------------------------------------------
|