Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MSNLSPYPPAIHSPFPASAPQTPGASSADDSSDSEPDASAPFTPFTPYTPGPDGPGVNSPGRSPTTPREFLGLKGSERRRPEGTLGHVELLLEALAEELNTLQTRAEAVYAPRREEDGPLIHATVREVVDKLQQLEEAAPGLDEWVPIQVLEYLDEGRNPDDYTRTMLELTAAENQFTNGKVHAVHSYLQLLSAGIAEAFPDMAEFVPPPQIPLDDMPSAQDEGGMSGQEKSKEVREVPIVVIDEAPKVEDSAAPKGEQAVPGIPVDASQDLGGHIDVGIEEPLAPAAPTAGQ |
Length | 293 |
Position | Middle |
Organism | Dacryopinax primogenitus (strain DJM 731) (Brown rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Dacrymycetes> Dacrymycetales> Dacrymycetaceae> Dacryopinax. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.488 |
Instability index | 61.06 |
Isoelectric point | 4.29 |
Molecular weight | 31158.08 |
Publications | PubMed=22745431 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31097 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.27| 16| 20| 33| 51| 1 --------------------------------------------------------------------------- 9- 24 (31.94/ 9.45) PAIHSPFPASAPQTPG 36- 51 (33.32/16.48) PDASAPFTPFTPYTPG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 72.82| 20| 20| 121| 140| 2 --------------------------------------------------------------------------- 66- 81 (21.33/10.16) ........TPREFLG.LKGSERR..RP 86- 112 (19.35/ 8.62) GHVellleALAEELNTLQTRAEAvyAP 121- 140 (32.14/18.57) IHA.....TVREVVDKLQQLEEA..AP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.82| 21| 51| 199| 225| 3 --------------------------------------------------------------------------- 199- 224 (29.30/25.11) AFPDMAEFVppPQIPLDdmpSAQDEG 253- 273 (36.52/15.26) AAPKGEQAV..PGIPVD...ASQDLG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DASAPFTPFTPY 2) HIDVGIEEPLAP | 37 275 | 48 286 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab