<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31094

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMTEQKQSEPNGIVSPNSNHVNGNQHAMISAKTVAPAAGPPPLPQELSDMVPLREIIARLVQKSYEDLQNLIEVLPSKSDVERKHAIRDYGSHTRKQVVKALVLTRWARDSAVVQRCQDVRFFLQVQNGQFREASQRLYAIKEGFMGARSRQWDLLTAIDVLSTGKYLRLPKAIKEWFLPPTPPSPASALQTLQQMDHVLRLRLRAREIIPIEMSRYSVSSGRVTFTAPNLFRASFVTGGAEPSQIWYLLGLEFLIGAKDKTRVFERFPRKPQGFMRDQIINLVNQQLALGHDPGTRTGDAGVGAQEQEPHARRRRKGKVVTVDAPLVRAYNFLQMFALSYQLEILSYQASQLLSSLGWASHLRLEHSRDRRTLTASYWQRPRPPPPAGNPPWPASQSKIYGGTVTVSLESRAHQGRTALGKVLADLEDRTKSGHTRSDVTVRTRDTVDGLRLRVIWTPSRAWLGVEFAQDELQGEEFDVDPSDLDFERSVMRRVVGQHAGAVVGRWGAAMRRGPAGVVWREEEMKIAEAEGGTTELHLRFRPQELTVISLDGRSGAFVVREQGVLPSVSRSEKIAALVKQINDKPGTFVEAVCMTRFQILLEDLENNATVLRTHVTRTRLVRPQDMPAFGSSARLCLYISLASFPSHYLVLVLADQGLQYAMLKVALVNEDVAPDFRILECAWLDIRRITGQDPARDPGLRWSISQDALCDLYAFCRARVAHAELEQQLRDVKIASWPTFDSPSAGGSRLETLPLAPPLLQKEVPTIRIESSAFLGAMSSDASTMSADAWCAYIALRAINWTRLYGSVGAIVSVALRSEFFVPLADEKSTTGEYAGVRVKLDSKTGVINFHLENVHGAILAFLRAWEGVSKAVSVAREVRTMSQEPRYTGVQLLSFTLSSVSLLYQNSFALTISSHGATSLGFSYHGTPGRRNPHEEGVDHYSRVFEESGPRKLIEILRDTLPLLLEFDQLDVSAQMRWSLREAGWVRAVYGQEPHALDYRLLPNSRILVVDGAVHLFNSAGKVLFTQHPIVDLMRESSEKFSGVYKVIDGLPNLLLDVTRSVAKERVGISESGNRKMPDVIPLDAGLICHQDAVRDVVRLMHEGMLKLLDKEDKGKAKEKS
Length1122
PositionTail
OrganismDacryopinax primogenitus (strain DJM 731) (Brown rot fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Dacrymycetes> Dacrymycetales> Dacrymycetaceae> Dacryopinax.
Aromaticity0.07
Grand average of hydropathy-0.246
Instability index47.58
Isoelectric point9.19
Molecular weight125253.80
Publications
PubMed=22745431

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP31094
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.14|      16|      83|     413|     433|       7
---------------------------------------------------------------------------
  396-  411 (26.77/14.06)	QSKIYGGTVTVSLESR
  414-  429 (26.37/17.71)	QGRTALGKVLADLEDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.82|      35|     406|     341|     378|      11
---------------------------------------------------------------------------
  341-  378 (52.96/48.15)	QLEILSYqASQLLSSlgWASHLRLE.......HSRDRRTLTASYW
  749-  790 (54.85/37.41)	RLETLPL.APPLLQK..EVPTIRIEssaflgaMSSDASTMSADAW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.57|      25|     406|      90|     120|      12
---------------------------------------------------------------------------
   90-  120 (39.06/31.15)	GSHTrkqvvkALVLTRWA....RDSA.VVQRCQDVR
  496-  525 (38.51/19.58)	GQHA......GAVVGRWGaamrRGPAgVVWREEEMK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.18|      22|      88|     960|     985|      16
---------------------------------------------------------------------------
  960-  985 (35.17/32.22)	DTLPLLLefdqLDVS...AQMRWSLREAG
 1050- 1074 (34.02/20.35)	DGLPNLL....LDVTrsvAKERVGISESG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.02|      15|     681|     256|     270|      17
---------------------------------------------------------------------------
  256-  270 (28.36/17.51)	GAKDKTRVFERF.PRK
  938-  953 (24.66/14.28)	GVDHYSRVFEESgPRK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.74|      10|     300|     683|     694|      19
---------------------------------------------------------------------------
  683-  694 (16.58/15.97)	WldIRRITGQDP
  986-  995 (21.17/12.43)	W..VRAVYGQEP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31094 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MTEQKQSEPNGIVSPNSNHVNGNQHAMISAKTVAPAAGPPPLPQE
1
45










Molecular Recognition Features






MoRF SequenceStartStop




NANANA