<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31062
Description |
Uncharacterized protein |
Sequence | MDQFSGGGNWSMIPNVQAQGNFAIGSDSAAAPVFSFPFPSLSCKQQTKLSSFYGNHCVCVSNVCYWQLVEKLSDAVETGTRDQNSDALVSELNGHFDKCQQLLNSISGSLGSKTTMTVDGQKRNLEESEQLLQQRRDLIMEYRKSIEDLVKIEP |
Length | 154 |
Position | Middle |
Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.410 |
Instability index | 41.87 |
Isoelectric point | 4.95 |
Molecular weight | 17047.91 |
Publications | PubMed=21873998
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP31062
No repeats found
|