<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31056
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQVNSIAAITFNAFGTLQRDAPPVQLSPNYPEPPAAAATTTTTTTATDGDATAAFPEQPKQLSADLVKAAKQFDALVAALPLSEGGEEAQLKRIAELQVENDLIGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKPE |
| Length | 148 |
| Position | Middle |
| Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.358 |
| Instability index | 55.17 |
| Isoelectric point | 4.36 |
| Molecular weight | 15862.60 |
| Publications | PubMed=21873998
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31056
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.48| 23| 23| 58| 80| 1
---------------------------------------------------------------------------
38- 55 (20.14/ 8.06) ......YPEPPAAAATTTTTTTAT
58- 80 (36.02/19.68) DA.TAAFPEQPKQLSADLVKAAKQ
82- 104 (23.32/10.38) DAlVAALPLSEGGEEAQLKRIAE.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.61| 17| 20| 110| 126| 2
---------------------------------------------------------------------------
110- 126 (26.50/16.83) DLIGQELQKQLEAAEKE
132- 148 (30.11/19.98) ELFGQAADNCLNMKKPE
---------------------------------------------------------------------------
|