Description | Uncharacterized protein |
Sequence | MDIISQLQEQVNSIAAITFNAFGTLQRDAPPVQLSPNYPEPPAAAATTTTTTTATDGDATAAFPEQPKQLSADLVKAAKQFDALVAALPLSEGGEEAQLKRIAELQVENDLIGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKPE |
Length | 148 |
Position | Middle |
Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.358 |
Instability index | 55.17 |
Isoelectric point | 4.36 |
Molecular weight | 15862.60 |
Publications | PubMed=21873998 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31056 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 79.48| 23| 23| 58| 80| 1 --------------------------------------------------------------------------- 38- 55 (20.14/ 8.06) ......YPEPPAAAATTTTTTTAT 58- 80 (36.02/19.68) DA.TAAFPEQPKQLSADLVKAAKQ 82- 104 (23.32/10.38) DAlVAALPLSEGGEEAQLKRIAE. --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.61| 17| 20| 110| 126| 2 --------------------------------------------------------------------------- 110- 126 (26.50/16.83) DLIGQELQKQLEAAEKE 132- 148 (30.11/19.98) ELFGQAADNCLNMKKPE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAFPEQPKQLSADLVKAAKQFDALVAAL 2) EAQLKRIAELQ | 61 96 | 88 106 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab