<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31042
| Description |
Uncharacterized protein |
| Sequence | MDNNNWRPSILNGESAAMNNGEWRNQLPPDSRQKIANKMMFFFFAGGLGQQVRQVLKSGAGKCIRCGSEADLVDYDKVLKLFFVPVWRWPGKDQVLHCRDCDLFFPPPISLATCRFCDRVVEPEFRFCPFCGSSL |
| Length | 135 |
| Position | Tail |
| Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.253 |
| Instability index | 39.83 |
| Isoelectric point | 8.47 |
| Molecular weight | 15427.67 |
| Publications | PubMed=21873998
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31042
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.93| 14| 15| 89| 102| 1
---------------------------------------------------------------------------
89- 102 (30.61/20.30) WPGKDQVLHCRDCD
105- 118 (29.32/19.16) FPPPISLATCRFCD
---------------------------------------------------------------------------
|