<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31037
| Description |
Uncharacterized protein |
| Sequence | MLCGYLMDNNNLIPSLPKGEPAMDTCDWRAQLPSDSREKIIGKIMETLRKQLPYSGTEEIKELRRIASRFEERIFGCAANPMLTMETTKLQSAASSYSLPLNPGWHQMTIEGPIKAEPAVNTSDWRTCLPPDSLCTVCLSLRNSSYLCLLQSQLKAKVL |
| Length | 159 |
| Position | Tail |
| Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.286 |
| Instability index | 61.03 |
| Isoelectric point | 7.52 |
| Molecular weight | 17823.53 |
| Publications | PubMed=21873998
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31037
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.55| 19| 95| 18| 36| 1
---------------------------------------------------------------------------
18- 36 (40.54/22.80) KGEPAMDTCDWRAQLPSDS
115- 133 (40.01/22.43) KAEPAVNTSDWRTCLPPDS
---------------------------------------------------------------------------
|