<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31031
| Description |
Uncharacterized protein |
| Sequence | MERTTTQQQQAPPVAEELNLDYVKRQTQSLQEAISRILEDFEAYSQTNTTPKWKDILGRYKMINLDLFILVEEVKQVSKALVVFPKNVNAENASILPVMLASKLLPEMETDNNVKIDQLLQDVQSLPIPMQIETLKERIGKIAEACENAGKVLADARKAYGLAPQRGGPSMLPTTMDKAQAAKIREQENMLRAAVNEGEGLRLPPEQRQITTALPPHMVDALFVNDGVFNSSGMMQTHQSQSQQPEQQQHQQQGGYGNK |
| Length | 259 |
| Position | Head |
| Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.556 |
| Instability index | 56.37 |
| Isoelectric point | 5.39 |
| Molecular weight | 28978.71 |
| Publications | PubMed=21873998
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31031
No repeats found
No repeats found
|