Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MEEGRQKDLQLLEEIIDKGLKEKLLQTIASRDKIFEEQKVLSDLRKNLETLEENGVNSLKTMVNPGSEVYMQAHVLIDDGKNPDEFARDVLNSCVARNQATKGKTDAFKELRKHILEELEETFPDEVDKYREIRATSAAEAKRLAQSQTVLPNGDAKVKSEL |
Length | 162 |
Position | Middle |
Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.752 |
Instability index | 39.76 |
Isoelectric point | 5.06 |
Molecular weight | 18398.58 |
Publications | PubMed=21873998 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31029 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 77.52| 28| 38| 39| 76| 1 --------------------------------------------------------------------------- 6- 37 (31.68/10.23) QKDLQLLEEiidKGLkEKLLQTIASRDKIFEE 45- 72 (45.84/48.63) RKNLETLEE...NGV.NSLKTMVNPGSEVYMQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DKYREIRAT 2) FARDVLNSCVARN 3) FKELRKHI 4) KRLAQS 5) LQLLE | 128 86 108 142 9 | 136 98 115 147 13 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab