<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31020
| Description |
Uncharacterized protein |
| Sequence | MEQEEVDVVHPLDKERGISVEDFKLIKFHMSNHMIKLAQHIKVRQRKSMVEFEPRLVALACMYLASKAEESIGMKVLEALNYYLVVFHPYHSLSEFLQDAAINDVNMNQITWGIVNDTYTMDLILVHPPYRIALACIYIASVHTEKDITAWFEDLHEDMNLVKNIAMEILDFYENYRSITEEKVNSAFSKLALKP |
| Length | 195 |
| Position | Kinase |
| Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.067 |
| Instability index | 36.17 |
| Isoelectric point | 5.33 |
| Molecular weight | 22695.02 |
| Publications | PubMed=21873998
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP31020
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.69| 19| 73| 54| 72| 1
---------------------------------------------------------------------------
54- 72 (34.62/24.52) PRLVALACMYLAS.KAEESI
129- 148 (32.07/22.26) PYRIALACIYIASvHTEKDI
---------------------------------------------------------------------------
|