Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSSPKEMDDTSEPTSPPKNTYNDPDGGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNPNFRTAMAHPANKELAHRQQFYYWKNYRNNRLKHILPRPLPEPVAPPPPAPSAPAAPSPAPSPMQYNNMTAKNEPRNMVSTGIDRRKRKYVLLSSSS |
Length | 191 |
Position | Middle |
Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica. |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.820 |
Instability index | 68.51 |
Isoelectric point | 9.24 |
Molecular weight | 22402.27 |
Publications | PubMed=21873998 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31018 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.57| 20| 27| 31| 50| 1 --------------------------------------------------------------------------- 31- 50 (36.56/21.81) FLLELEFVQCLANPTYIHYL 61- 80 (39.01/23.68) FIGYLKYLQYWQRPEYIKFI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.87| 19| 26| 86| 104| 2 --------------------------------------------------------------------------- 82- 102 (28.49/11.35) YP........hcLYFLELLQNPNFRTAMA 103- 131 (29.38/11.86) HPankelahrqqFYYWKNYRNNRLKHILP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FYYWKNYRN 2) PRNMVSTGIDRRKRKYVLLS | 115 169 | 123 188 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab