<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31011

Description Uncharacterized protein
SequenceMDTATQPPQGQPPPVAEKLNPELVQLLNLESVKTRADSLFKAISRILEDFDAYGRTNTSPKWQDILGQYSMVNLELFNIVEEVKKVSKAFVVLPKNVNAENAQILPVMLSSKLLPEMEADDNVKREQLLQGVQNLPVPMQIEKLKERMSLIAQACENAEKTLADTRKAYGFGARQGPSMLPTMDKVQVAKIQEQESMLRAAVNDGAGTRLPPDQRQITTALPPHLVDVLFVNDAGKNALPVASNNINSQGNMMQVSGTQFMGRSAASPSNANFDTTRSPLPYSNSPYQSSMQGLGQSQMPSLHDLQAQQKFQSLHGQQHQMPYSQSMGHQQYQARQLSGGHIQHGMSQGQLNPAMLNRQLNQFSGGANSAMFTSAQGSPSSQMIPNMSSMQSQTLNPRMQQYGVSGTNAQRGHASQMLGDQSDFPCDADLSPLFSPFLDRFDAGLSPPGAEMDPLEEIRDSKRQLEYLNHLGNVADSEYGMPRRCACGGRMIDKLRVKDEFDTQPGKRFFSCVTYEADGLHYRQPWIIGVQGEMVRLRKRVEEADEVIKWVPILNKQIESVEVKVVGSGGHGFYKVYCFCRSRVVEVTGSRGHGFWRSRVLLAQHVFF
Length608
PositionHead
OrganismBrassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
Aromaticity0.07
Grand average of hydropathy-0.496
Instability index54.94
Isoelectric point7.21
Molecular weight67507.86
Publications
PubMed=21873998

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP31011
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      72.18|      19|      20|     291|     309|       1
---------------------------------------------------------------------------
  291-  306 (25.37/11.05)	....MQGL.GQS.QMPSLHDL.Q
  307-  328 (20.93/ 7.76)	AQQkFQSLhGQQhQMPYSQSM.G
  329-  348 (25.88/11.42)	HQQ.YQAR.QLS.GGHIQHGMsQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.30|      13|      20|     563|     575|       2
---------------------------------------------------------------------------
  563-  575 (26.39/16.15)	VKVVGSGGHGFYK
  585-  597 (27.91/17.48)	VEVTGSRGHGFWR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.73|      16|      26|     202|     217|       3
---------------------------------------------------------------------------
  202-  217 (30.38/14.99)	VNDGAGTRLPPDQRQI
  231-  246 (24.35/10.77)	VNDAGKNALPVASNNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.76|      22|      25|     495|     518|       5
---------------------------------------------------------------------------
  495-  518 (30.45/29.90)	LRVKDEF..DTQpGK..RFFSCVTyEAD
  520-  545 (31.32/18.90)	LHYRQPWiiGVQ.GEmvRLRKRVE.EAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.33|      11|      15|     452|     462|       6
---------------------------------------------------------------------------
  452-  462 (19.00/13.71)	MDPLEEIRDSK
  468-  478 (18.34/12.97)	LNHLGNVADSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.27|      17|     201|     171|     187|       7
---------------------------------------------------------------------------
  171-  187 (32.88/19.30)	FGARQG.PS..MLPTMDKVQ
  372-  391 (23.39/11.70)	FTSAQGsPSsqMIPNMSSMQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31011 with Med8 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) GGANSAMFTSAQGSPSSQMIPNMSSMQSQTLNPRMQQYGVSGTNAQRGHASQMLGDQS
2) LPVASNNINSQGNMMQVSGTQFMGRSAASPSNANFDTTRSPLPYSNSPYQSSMQGLGQSQMPSLHDLQAQQKFQSLHGQQHQMPYSQSMGHQQYQARQLSGGHIQHGMSQGQLNPAMLNRQLNQF
365
239
422
363

Molecular Recognition Features

MoRF SequenceStartStop
NANANA