<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30990

Description Uncharacterized protein
SequenceMNLTSSPFFIDDVNSLIAVGCNAKVSLTHVKPNMVGCDLICNTSKDHPSKTIPFLDKTGCSSNSLSYKYADCTENKIEEEEPECDGNAYTPDGCKDVDECKITPPICGEGEGYTCVNTQGRFRCVADKKKAILIGVGAGFGVLALVGGVWWLRKFLINRKITKRKKMFFHRNGGLLLQQELSTSEGRVEKTRIFSSIELEKATENFSENRVLGQGGQGTVYKGMLVDGRTVAVKKSKVIDEDKLQEFINEVVILSQINHRHIVKLLGCCLETEVPMLIYEFIVNGNLFQHIHEESDDYAMIWGMRLRIAVDVAGALSYLHTSASSPIYHRDIKSTNILLDEKYRAKVADFGTSRSITIDQTHWTTVVSGTVGYLDPEYYQSSQYTEKSDVYSFGVVLAELVTGERPVIKIQNTQETRSLAEHFRAAIKEKRLSDIMDARIKKNFLTLVHYFNTLKCSANVLDSSGSLSPGFFPRPGSEGPPPPFLPAGSLPGSIMTNPDNLVTPHRFSAAARTLIEFWEENTRKAKSLCEEQNHRRRRLLLGSFLTIVILGVGLNAKSWMVYQPQPSPSSDSSPSPTDRFPGITSPETPSNNQNLEIEDMFAS
Length603
PositionHead
OrganismBrassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
Aromaticity0.08
Grand average of hydropathy-0.289
Instability index44.71
Isoelectric point6.56
Molecular weight67065.65
Publications
PubMed=21873998

Function

Annotated function 
GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
plasma membrane	GO:0005886	IBA:GO_Central

GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein serine/threonine kinase activity	GO:0004674	IBA:GO_Central

GO - Biological Process
cell surface receptor signaling pathway	GO:0007166	IBA:GO_Central
protein phosphorylation	GO:0006468	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30990
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.74|      19|     106|     462|     483|       1
---------------------------------------------------------------------------
  462-  483 (34.33/27.46)	DSSGSLSPGFfprPGSEGPPPP
  571-  589 (38.41/21.49)	DSSPSPTDRF...PGITSPETP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.76|      20|     110|     108|     129|       4
---------------------------------------------------------------------------
  108-  129 (34.01/29.29)	GEGEGYTCVNTQGrfRCVADKK
  216-  235 (35.75/23.18)	GQGTVYKGMLVDG..RTVAVKK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30990 with Med28 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) VYQPQPSPSSDSSPSPTDRFPGITSPETPSNNQNLEIEDM
561
600










Molecular Recognition Features






MoRF SequenceStartStop




NANANA