<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30981
| Description |
Uncharacterized protein |
| Sequence | MEPERTKFGGPKELCGAVDLLSQYKLSQHHEFFCKKSLSASLSDSHYLHNVVGDTEIRKGEGMQLDQLVQNMSQTRETNSTRIQPFEMDELMEAFQLSDTTPVELPLEEKGAPTIPPKSKSESKDKDRKHKKHKDRSKDKDREHKKHKHRHRDRSKDKDKDRDRKKEKNGHHDSGEHSKKHHDKKRKHDGDEDLNDIHRHKKNKHKSSKLDEMGAIRVGG |
| Length | 220 |
| Position | Head |
| Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.645 |
| Instability index | 36.44 |
| Isoelectric point | 9.32 |
| Molecular weight | 25641.37 |
| Publications | PubMed=21873998
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30981
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.67| 17| 17| 129| 145| 1
---------------------------------------------------------------------------
129- 145 (33.82/11.05) KHK.KHKDRS..KDKDRE........HK
146- 165 (23.90/ 6.03) KHKhRHRDRSkdKDKDRD........RK
177- 201 (23.95/ 6.06) HSK.KHHDKK..RKHDGDedlndihrHK
---------------------------------------------------------------------------
|