<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30968
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASPEEMVDDASETPSTPKSTYKDPDGGRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIEYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNPNFRSAMAHPANKELAHRQQFYYWKNYRNNRLKHILPRPLPEPVAPQPPPVPSSSLPPAPSATAAPSPSPMQYNNMLAKNETRNMVSAGIDRRKRKYVLLSSS |
| Length | 198 |
| Position | Middle |
| Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.707 |
| Instability index | 71.40 |
| Isoelectric point | 8.95 |
| Molecular weight | 23147.15 |
| Publications | PubMed=21873998
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30968
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.31| 20| 27| 32| 56| 1
---------------------------------------------------------------------------
32- 51 (36.49/17.77) FLLELEFIQCLANPTYIHYL
62- 81 (37.82/26.56) FIEYLKYLQYWQRPEYIKFI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.53| 25| 26| 87| 111| 2
---------------------------------------------------------------------------
87- 111 (41.86/22.80) LYFLELLQNPNFRSAMAHPANKELA
116- 140 (46.67/26.17) FYYWKNYRNNRLKHILPRPLPEPVA
---------------------------------------------------------------------------
|