<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30967
| Description |
Uncharacterized protein |
| Sequence | MESESAKFGGPRELGGARDLITQYKLLPHHEFFCKRSLPESLSDAHYLHNVVGDTDIRKGEGMQLDQLIPNASHNRDGNARIQPFVLDELKEAFEINDTSPVELPPAEKGALTIASKSKSESKDRDRKHKKHKDRNKDKDREHKKHKHKHKDRSKDKDKDKDRERKKEKSGHHDKKRKHNGNEDLDDAQRHKKSKVMAYVGISSLVRKAEVG |
| Length | 212 |
| Position | Head |
| Organism | Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.444 |
| Instability index | 38.97 |
| Isoelectric point | 9.52 |
| Molecular weight | 24386.07 |
| Publications | PubMed=21873998
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30967
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.60| 19| 21| 132| 152| 1
---------------------------------------------------------------------------
132- 152 (34.92/18.78) HKDrnKDKDREHKKHKHKHKD
156- 174 (36.68/15.25) DKD..KDKDRERKKEKSGHHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.85| 17| 23| 49| 68| 2
---------------------------------------------------------------------------
49- 68 (25.60/26.79) HNVVGDTDIrkgEGMQLDQL
74- 90 (31.25/21.97) HNRDGNARI...QPFVLDEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.31| 13| 15| 91| 103| 3
---------------------------------------------------------------------------
91- 103 (22.13/11.97) KEAFEINDTSPVE
109- 121 (20.18/10.46) KGALTIASKSKSE
---------------------------------------------------------------------------
|