| Description | Uncharacterized protein |
| Sequence | MQSSGRAGGDVDRALSSIRARADHLRHTVSRLEHNLAWNPASTWPELLSQYMVIAKQLENMNDEIPDLVQHFACVPRMSTPNSADIPLLLRTREDPEMEEAERQLLVGKARDKNTEALQKLVAAHNDAVEGLEETFNDMSDGLLKAIRVNKYVVKSKPQSTQSQQFKYIESGSYE |
| Length | 175 |
| Position | Head |
| Organism | Hyaloperonospora arabidopsidis (strain Emoy2) (Downy mildew agent) (Peronospora arabidopsidis) |
| Kingdom | Oomycetes |
| Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae> Hyaloperonospora. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.625 |
| Instability index | 50.48 |
| Isoelectric point | 5.58 |
| Molecular weight | 19732.97 |
| Publications | PubMed=21148394 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP30959
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.96| 15| 15| 85| 99| 1
---------------------------------------------------------------------------
85- 99 (25.39/16.71) DIPLLLRTREDPEME
102- 116 (23.57/15.07) ERQLLVGKARDKNTE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IPLLLRTR 2) SQQFKYIESGS | 86 163 | 93 173 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab