Description | Uncharacterized protein |
Sequence | MQSSGRAGGDVDRALSSIRARADHLRHTVSRLEHNLAWNPASTWPELLSQYMVIAKQLENMNDEIPDLVQHFACVPRMSTPNSADIPLLLRTREDPEMEEAERQLLVGKARDKNTEALQKLVAAHNDAVEGLEETFNDMSDGLLKAIRVNKYVVKSKPQSTQSQQFKYIESGSYE |
Length | 175 |
Position | Head |
Organism | Hyaloperonospora arabidopsidis (strain Emoy2) (Downy mildew agent) (Peronospora arabidopsidis) |
Kingdom | Oomycetes |
Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae> Hyaloperonospora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.625 |
Instability index | 50.48 |
Isoelectric point | 5.58 |
Molecular weight | 19732.97 |
Publications | PubMed=21148394 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30959 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.96| 15| 15| 85| 99| 1 --------------------------------------------------------------------------- 85- 99 (25.39/16.71) DIPLLLRTREDPEME 102- 116 (23.57/15.07) ERQLLVGKARDKNTE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IPLLLRTR 2) SQQFKYIESGS | 86 163 | 93 173 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab