<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30949

Description Cyclin-dependent kinase 8
SequenceMDYDFKVKLTGERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPLQLPRGMVKSLLYQILDGIHYLHTNWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIRRITSEQAMQDPYFLEEPLPTSDVFAGCQIPYPKREFLTEEEPEDKGDKKNQQQQQGNNHTNGAGHTGNPDNSHAQGPPLKKVRVVPPTTTSGGLLISSDYQRSNPHAAYQNPGPSTSLPQSSMGYSSTSQQPPQYSHQTHRY
Length464
PositionKinase
OrganismXiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae> Xiphophorus.
Aromaticity0.09
Grand average of hydropathy-0.691
Instability index40.10
Isoelectric point8.73
Molecular weight53307.12
Publications
PubMed=23542700

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30949
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     114.94|      33|      36|     280|     313|       1
---------------------------------------------------------------------------
  280-  313 (54.91/32.32)	MKDFRRNTYTNCSLIKYMEKHKVkPDSKAFHLLQ
  318-  350 (60.03/31.79)	MDPIRRITSEQAMQDPYFLEEPL.PTSDVFAGCQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.44|      15|      37|     151|     165|       2
---------------------------------------------------------------------------
  151-  165 (26.77/18.09)	DLKPANILVMGEGPE
  189-  203 (28.67/19.86)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.25|      13|      39|     125|     142|       3
---------------------------------------------------------------------------
  125-  142 (19.50/26.91)	RGMVKsllyqILD.GIHYL
  166-  179 (19.74/12.32)	RGRVK.....IADmGFARL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30949 with CDK8 domain of Kingdom Metazoa
Unable to open file!