<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30929
| Description |
Mediator of RNA polymerase II transcription subunit 1 |
| Sequence | XXXXXXNVVEFTIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRIPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSISFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGEPGLNCFTLPENQGALHFSTGWRRRGRINQAWDTSLLSRCTHSSVSKEGKDMKSTSTYLLLLVSYVFSV |
| Length | 592 |
| Position | Middle |
| Organism | Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hylobatidae>
Nomascus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.119 |
| Instability index | 48.07 |
| Isoelectric point | 8.26 |
| Molecular weight | 64999.34 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30929
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.41| 15| 98| 362| 390| 1
---------------------------------------------------------------------------
362- 377 (23.39/39.48) RSLQGTLVSkITFQHP
419- 433 (30.02/10.64) CPLSESRFS.ISFQHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 84.53| 21| 25| 295| 315| 6
---------------------------------------------------------------------------
271- 289 (18.03/ 7.38) ......NSVDLPacFFLKFPQPIPV
295- 315 (39.00/24.54) Q.KL.QNCTGIP..LFETQPTYAPL
321- 343 (27.50/15.13) QfELsKDPDPIP..LNHNMRFYAAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 153.82| 47| 48| 122| 169| 7
---------------------------------------------------------------------------
122- 169 (78.61/59.25) NFDEFSKHLKGLVNlYNLP..GDNKLKTKMYLALQSLEQDLSKMAIMYWK
172- 220 (75.21/52.09) NAGPLDKILHGSVG.YLTPrsGGHLMNLKYYVSPSDLLDDKTASPIILHE
---------------------------------------------------------------------------
|