<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30928
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAASSSGEKEKERPGGGSGAAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLPPDEENQVLELLIHRDGEFQELMKLAVNQGKIHHEMQVLEKEVEKRDRDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSNDFLLEPLGHNKENEDDVEVMSTDSSSSSSDSD |
Length | 270 |
Position | Middle |
Organism | Mustela putorius furo (European domestic ferret) (Mustela furo) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Mustelinae>
Mustela.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.687 |
Instability index | 47.24 |
Isoelectric point | 5.02 |
Molecular weight | 29798.08 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30928
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.64| 25| 29| 28| 54| 1
---------------------------------------------------------------------------
30- 54 (40.19/30.89) LLSALED...LEVL.SR..ELIEMLAISRNQ
56- 86 (29.45/14.42) LLPPDEEnqvLELLiHRdgEFQELMKLAVNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.13| 22| 23| 94| 115| 2
---------------------------------------------------------------------------
94- 115 (33.75/23.01) QVLEKEVEKRDRDIQQLQKQLK
119- 140 (32.38/21.83) QILATAVYQAKEKLKSIEKARK
---------------------------------------------------------------------------
|