<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30927
| Description |
Mediator complex subunit 29 |
| Sequence | KETGRKPLVAHFRCAKLRKMAASQQQGAAASSAAGVSGPGSSGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLDCANKVTGKTPAPPTGPGGTL |
| Length | 219 |
| Position | Tail |
| Organism | Mustela putorius furo (European domestic ferret) (Mustela furo) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Mustelinae>
Mustela.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.423 |
| Instability index | 62.38 |
| Isoelectric point | 8.61 |
| Molecular weight | 23263.30 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30927
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 100.93| 30| 167| 10| 46| 1
---------------------------------------------------------------------------
10- 46 (48.83/35.50) AHFRCAKlrkmaasQQQGAAASSAAGVSG..PGSSGGPG
185- 216 (52.10/25.96) AQIACAK.......DIHTALLDCANKVTGktPAPPTGPG
---------------------------------------------------------------------------
|