Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKTTDARHRDRAGVEKTMENFSALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTATAAPPGADKSAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHSYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSLR |
Length | 261 |
Position | Head |
Organism | Mustela putorius furo (European domestic ferret) (Mustela furo) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Mustelinae> Mustela. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.057 |
Instability index | 60.46 |
Isoelectric point | 9.89 |
Molecular weight | 28199.87 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30896 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 79.91| 16| 16| 207| 222| 2 --------------------------------------------------------------------------- 187- 200 (25.73/10.85) P..PKKKNKHKHKQSR 207- 222 (27.40/11.99) PETPSDSDHKKKKKKK 226- 241 (26.77/11.56) PERKRKKKEKKKKKNR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 131.62| 40| 46| 85| 130| 4 --------------------------------------------------------------------------- 85- 128 (68.72/42.97) MRELPGSTELTGSTNLITHYN.LEHSYNKFCGkkvkEKLSNF......LPD 132- 178 (62.90/27.55) MIDLPGSHDNSSLRSLIEKPPiLGGSFNPITG....TMLAGFrlhtgpLPE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSP 2) GVEKTMENFSALFGA | 212 13 | 244 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab