<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30894
| Description |
Cyclin C |
| Sequence | MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLTEEEYWKLQIFFANVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYDQWKNFDERKEMAAILSKMPKPKPPPNSEGEQNPNGSQNSTYSQS |
| Length | 283 |
| Position | Kinase |
| Organism | Latimeria chalumnae (Coelacanth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Coelacanthiformes> Coelacanthidae> Latimeria.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.159 |
| Instability index | 50.14 |
| Isoelectric point | 6.95 |
| Molecular weight | 33269.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30894
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.47| 26| 30| 16| 45| 1
---------------------------------------------------------------------------
16- 45 (34.33/34.42) LDK.QDLLKERQKDLKflTEEEYWKLqiFFA
48- 74 (38.13/24.19) IQAlGEHLKLRQQVIA..TATVYFKR..FYA
---------------------------------------------------------------------------
|