<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30893
| Description |
Mediator complex subunit 22 |
| Sequence | MSQQRVLPQSKETLLQSYNKRLKDDIKSVMDNFTEIIKTAKIEEETQVSRATQSEQDHYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNESINQNNQQLHSLQEECDKKLIALRDEIAIDLYELEEEYYSSSLCDTGDLPLCEVYWNQDSLGSPEGISTPPAPRMAEPMGTGAETSTPSHPHVNGQGAAPTEHA |
| Length | 200 |
| Position | Head |
| Organism | Latimeria chalumnae (Coelacanth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Coelacanthiformes> Coelacanthidae> Latimeria.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.657 |
| Instability index | 67.55 |
| Isoelectric point | 4.67 |
| Molecular weight | 22448.74 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30893
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.29| 15| 15| 155| 169| 1
---------------------------------------------------------------------------
155- 169 (28.23/12.62) DSLGSPEGISTPPAP
173- 187 (29.06/13.14) EPMGTGAETSTPSHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.45| 9| 15| 126| 135| 2
---------------------------------------------------------------------------
126- 135 (12.45/15.70) DLyELEEEYY
144- 152 (20.00/16.36) DL.PLCEVYW
---------------------------------------------------------------------------
|