<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30861
| Description |
Mediator of RNA polymerase II transcription subunit 7 (Fragment) |
| Sequence | MSNTSEDLISSLYPPPPPYYKFFTEENIQKLATWQSEKPTTTTTTNTEDAEEQVPPGHLRFLVPPNPPPGTQYRGYGNIWLFEDKLPSLKDSQWKQLYVDDDENITSETKIKELHKLMDSLLLNFLELIGILSVDPSKFDPKIQDINLILININHLLNTYRPHQSRESLIMLLKRQIAHKRSEIENIDKVCNDIKEKIKGLVNQEIPDSEVVHTKAQKIDEKDQIKQDIINKLLQSV |
| Length | 237 |
| Position | Middle |
| Organism | Candida maltosa (strain Xu316) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.632 |
| Instability index | 60.53 |
| Isoelectric point | 5.33 |
| Molecular weight | 27427.92 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30861
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.51| 17| 50| 12| 28| 1
---------------------------------------------------------------------------
12- 28 (36.62/18.98) LYPP.PPPYYKFFTEENI
62- 79 (31.89/15.80) LVPPnPPPGTQYRGYGNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.64| 26| 32| 166| 197| 2
---------------------------------------------------------------------------
172- 197 (43.36/37.54) LLKRQI.....AH.KRSEIENIDKVCNDIKEK
201- 232 (32.28/14.70) LVNQEIpdsevVHtKAQKIDEKDQIKQDIINK
---------------------------------------------------------------------------
|