<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30837

Description Uncharacterized protein
SequenceMDHGQRAALGGGMGQRPLPPKRAVSGSYAIQQGLKRPAVPSRLNNVRSVSQHGNYVDLTTSDAASSRNAAAFTNNTAARSISNSPNHVIDLSDEDHERPAKRARTGAGDMSPFEPGTSQHVSHQRWPGQPLPLPPTPRVPPTMGKSRRPAIHRLARKANGLEPPPCATRLAPPKQVADFAPWNGQHPEDVMTEGVVKGGYYDKAPGPNSTETNSAKPIIWPNLSAKNNMGLQTLSYLFTSVIEKRQALGKCTAPSTFKPPPRVTVTDTKREAWLRDLANPDVPLRKQSRTIPHGIRGKLLMEQCLSKNIPMPRAVWLAKCVGANELRAFRRKGVSGVAAATGESKWIQEWSVQVEHFLASVIAMCGQPEWQPKMDYAVKLATAFYAERLLDREHYLDWIISCFARAPMDQLPIWIILVQLYWKDITAFGRRGRQLAAATLESLQKLTQGDHRASNHVLVARLHKLVAVLAVTNRGCLVMPTAWRKYQHLLLSLRNIAPDAAQSITRRNLRLLAPLTKTSQNIRCPLLTLYGILDAHTTLYVDVERLTVACQNVMPDLDRLVAALLHWSASAYRVGESRAYLAAQVIMHLHSHAHDTDSAIMNYLRLTPTPDVVAADVYRVVADLARANCFSCGRYMQWLITSGALAGTETTGLATGLLTALPANITATHLQNTRKSLLQRVPTLRDDGDVVAATLDGVARRDSSSARHVPSEAIESLTATSRYELASSLTQELPSLLSDGSLDVGKFCNIRNALESTGDVRTLGEMLHMTMASNDVAVLASICDTINLHSTSFAAMGALLPMLNLMLDKYATLRSQLPLDRTWILALMALTQPFIDKASTLGRPQILAALPLDLSFCEQQTSLAVCSPASDSMVSMQAAGSLNSDQEIDAVFASGNTMDEQLMQRVFARIVQRAGKEVEGEAEQRTSPKLCVWLSQLHAVDSIAFDALAKSYVQEYLRGSGDIATTCVVISALVASGCVGLDSVVDFAQAIDTSTAASNMIHLLTSKLVANACLREAEAYRFHVMQQRVRTTCASRVISLLISALDDPQFPCEEPGLISLLMEYSASRYHACLQALAGAPSSSAVFLSNCGRVVTNILSVARGLPVADVRLDAPTMVAIADPISVVYCTCALSFLAKVETSSIQDSPDSTLQATIVEAIVNGSEVWPQLLESAGKHTIRSIYCWARDQILSGTSSGGDEISSVDDVQASRNLDILYASHHALQGDDNAHVVHSLTERIKALTERLPKAPLEADHKGDLSMLKLLLDLSVLYTTPDAVAESEDPKSGRDSLLVTLCVLLGHPGLQCHQGLLEYTYDVASALADTLPLEILAALSHTMARNGYRDPRLAVILGSTQSSESWLALVSYPQSQAVGGSAQAKALLQRAAQQQQQQQQQQSINAGRSGAMPSSCGPGALPRTMSMRSGQQAQAQGEAKTVPYVLRRWEVMSDATPSMGDNDTSLSLALFGARKVS
Length1470
PositionKinase
OrganismSphaerulina musiva (strain SO2202) (Poplar stem canker fungus) (Septoria musiva)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Sphaerulina.
Aromaticity0.05
Grand average of hydropathy-0.100
Instability index45.77
Isoelectric point8.12
Molecular weight159333.38
Publications
PubMed=23236275

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30837
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.60|      24|      30|      44|      69|       1
---------------------------------------------------------------------------
   44-   69 (38.97/32.22)	NN..VRSVSQHGNYV.DLttSDAASSRNA
   74-  100 (36.64/23.27)	NNtaARSISNSPNHViDL..SDEDHERPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.03|      25|      51|     665|     690|       2
---------------------------------------------------------------------------
  665-  689 (43.81/24.74)	ITATHLQNTRKSLLQRVPTLRDDG..D
  717-  743 (35.22/10.54)	LTATSRYELASSLTQELPSLLSDGslD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     166.51|      49|      52|    1250|    1299|       3
---------------------------------------------------------------------------
 1211- 1241 (34.74/18.76)	.......................NLDILYASHHAL.QG..DDNAHVVHSLTERIKAL..
 1250- 1299 (75.85/56.96)	LEAdHKGDL.......SMLKLLLDLSVLYTTPDAVAES..EDPKSGRDSLLVTLCVLLG
 1303- 1351 (55.92/35.96)	LQC.HQGLLeytydvaSALADTLPLEILAALSHTMARNgyRDPR.........LAVILG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     157.61|      46|      52|     205|     251|       4
---------------------------------------------------------------------------
  205-  251 (75.76/49.66)	PGPNSTETNSaKPIIWPNLSAKNNMGLQTLSYLFTSVIEKRQALGKC
  259-  304 (81.86/49.80)	PPPRVTVTDT.KREAWLRDLANPDVPLRKQSRTIPHGIRGKLLMEQC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      90.75|      21|      21|     821|     841|       5
---------------------------------------------------------------------------
  798-  813 (19.83/ 9.30)	.....ALLPMLNLMLDKYATL
  821-  841 (35.97/23.76)	RTWILALMALTQPFIDKASTL
  843-  863 (34.95/22.85)	RPQILAALPLDLSFCEQQTSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     145.25|      45|      54|     455|     499|       6
---------------------------------------------------------------------------
  455-  499 (77.49/54.54)	NHVLVARLHKL...VAVLAVTNRGCL.VMPTAWRKYQHLLLSLRNIAPD
  508-  556 (67.76/46.65)	NLRLLAPLTKTsqnIRCPLLTLYGILdAHTTLYVDVERLTVACQNVMPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.94|      19|      21|     140|     160|       7
---------------------------------------------------------------------------
  140-  160 (31.32/20.55)	PPTMGKSRRPaiHRLARKA..NG
  164-  184 (31.62/15.22)	PPCATRLAPP..KQVADFApwNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     199.68|      51|      56|    1033|    1083|       8
---------------------------------------------------------------------------
  967- 1027 (42.79/19.52)	CV..VISALVA...SgcvgLDsvvD..FaqaidtSTAASNMIHLL....TSKLvaNAC.LReaeAYRFHVMQQ
 1033- 1083 (88.76/47.74)	CASRVISLLIS...A....LD...DPQF......PCEEPGLISLLMEYSASRY..HAC.LQ...ALAGAPSSS
 1090- 1142 (68.14/35.08)	C.GRVVTNILSvarG....LP...VADV......RLDAPTMVAIADPISVV.Y..CTCaLS...FLAKVETSS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30837 with Med12 domain of Kingdom Fungi
Unable to open file!