<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30835
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAATAPAKDEIVHAHPGIVDWWVNEMGGKAMDENMIHRYMTESPFFEWSSKNGLLFEQGKVDWAIHTMCNNRKALEENLRQKPGLEFMIVQEPQPVADKELAAQGVTTGVYVIRKQDRQRATPGPRVRPPSVILEDRWELTVLGTYFIVGQNVYQSPSVFDVIENRLLSAASTLNKFVDTTLALPRYSPASGYSYLPQSQTSKRTAAVSLAGSPAGSREGSVVPGTDAHSLRSGSLVPDSTMATSKAASDYDQIRLLATSLAMSINYADDYTDENPLMGEPGNFKFAMTEAAVKKRRGEEEVAAAKAHAEKQSSLNSRADAARAETVPPKVEKAPAAFSTETKIKNDEKRKNSHASGKRKKSKKGINSAGPSPTTPSASSAPTPKAG |
| Length | 387 |
| Position | Head |
| Organism | Sphaerulina musiva (strain SO2202) (Poplar stem canker fungus) (Septoria musiva) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Sphaerulina.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.548 |
| Instability index | 47.62 |
| Isoelectric point | 9.01 |
| Molecular weight | 41980.80 |
| Publications | PubMed=23236275
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30835
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.38| 19| 41| 17| 35| 1
---------------------------------------------------------------------------
17- 35 (39.38/29.70) GIVDWWVNEM..GGKAMDENM
59- 79 (31.01/21.95) GKVDWAIHTMcnNRKALEENL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 247.10| 70| 76| 170| 240| 2
---------------------------------------------------------------------------
80- 131 (56.62/25.73) ..................RQKP..GLEFMivqePQPVADKELAA...QGVTTG..VY....VIRKQDRQRATPGPRVrPPS
170- 240 (111.75/61.15) AASTLN..KFVDTTLALpRYSPASGYSYL....PQSQTSKRTAAVSLAGSPAG..SREG.SVVPGTDAHSLRSGSLV.PDS
247- 315 (78.73/38.48) AASDYDqiRLLATSLAM...SINYADDYT....DENPLMGEPGNFKFAMTEAAvkKRRGeEEVAAAKAHAEKQSSL.....
---------------------------------------------------------------------------
|