Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MAPAQKITPAERIRELSDINKDVAAMLASAGQAVHALTNRPLHRDDDEMDDDTSASVDDRKQAFEASNTDFLEALQGVMARLRRQAYALEEAGIITPDPYAAGSEGLSKAQQQMQAQNRGNNNAPKIPPTQQLNPERIKNGGLGNFDVGWLNSRGNKVGAEKEAELIQEAKELLAKAKNNGDSIG |
Length | 185 |
Position | Head |
Organism | Pseudocercospora fijiensis (strain CIRAD86) (Black leaf streak disease fungus) (Mycosphaerella fijiensis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Pseudocercospora. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.741 |
Instability index | 29.87 |
Isoelectric point | 5.04 |
Molecular weight | 20004.97 |
Publications | PubMed=23236275 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30830 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 148.03| 45| 123| 3| 49| 1 --------------------------------------------------------------------------- 3- 49 (69.28/53.22) PAQKITPaERIRELSDINKDVaAMLASAGQAVHALTNRPLHRDDDEM 129- 173 (78.75/51.50) PTQQLNP.ERIKNGGLGNFDV.GWLNSRGNKVGAEKEAELIQEAKEL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AEKEAELIQEAKELLAKAKN 2) ERIREL 3) LNPERIK | 160 11 133 | 179 16 139 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab