Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MFAQFRASYARVEMSVQKLTDSIAAYNPSVRDAQELLAADEAVNHNIEQLVTHQQNHQRLVSLRATADSLDAAIKNTIRLLADTRREIQSIPSVDCEDRREVGVEELLQYAKFIAPTTLAPNPTFRKPLPDEHMPKKKEGATEVGANGIATPVDTAPAYTKSAEEKKDPEPAAPPAPAPAPAPAYDFVPWPDYGKITAGALGDIQRMLDAGQDPAAVLSAEEQAEVDTKRREQEAEERRRAEELERQQRDAFGDYSSGRRGTVVFNPDDL |
Length | 270 |
Position | Middle |
Organism | Pseudocercospora fijiensis (strain CIRAD86) (Black leaf streak disease fungus) (Mycosphaerella fijiensis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Pseudocercospora. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.678 |
Instability index | 58.79 |
Isoelectric point | 4.89 |
Molecular weight | 29773.76 |
Publications | PubMed=23236275 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30827 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.48| 17| 58| 115| 131| 1 --------------------------------------------------------------------------- 115- 131 (32.54/14.37) APTTLAP..NPTFR.KPLPD 173- 192 (26.95/10.92) APPAPAPapAPAYDfVPWPD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 77.15| 29| 55| 140| 168| 3 --------------------------------------------------------------------------- 137- 165 (50.84/32.60) KKE.........................GATEVGANG.IATPVDTA..PAYTKSAEE 166- 222 (26.31/13.61) KKDpepaappapapapapaydfvpwpdyGKITAGALGdIQRMLDAGqdPAAVLSAEE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AYDFVPWPDYGKIT 2) RDAFG 3) RRGTVVFN | 184 249 259 | 197 253 266 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab