<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30826
Description |
Uncharacterized protein (Fragment) |
Sequence | MASRTTAQRSRRAVVDRAARRANGLEPPSIATRLPPPKLVADFHPWNGHHAEDILTETVVKGGYFDKAPGPNSAETSSAKPTIWSNLSAKNNMGLQTLSYLFTSVMEKRQAIGRVTAPSTFKPPPRVTVTDTKREAWLRDLANPDVPLRKQSRTIPHGVRGKSLMEQCLGKDIPMPRAVWLAKCVGANELRAFRRKGVSGAAAATGEAKWVREWTVSVEQFLEGVIACCGQPAWQLKMDYA |
Length | 241 |
Position | Kinase |
Organism | Pseudocercospora fijiensis (strain CIRAD86) (Black leaf streak disease fungus) (Mycosphaerella fijiensis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Pseudocercospora.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.432 |
Instability index | 42.11 |
Isoelectric point | 10.10 |
Molecular weight | 26512.18 |
Publications | PubMed=23236275
|
Function
Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
ECO:0000256 ARBA:ARBA00002895
ECO:0000256 ARBA:ARBA00003744
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30826
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.51| 21| 87| 20| 42| 1
---------------------------------------------------------------------------
20- 42 (35.91/26.07) RRANG.LEPPSiaTRLPPPKL.VAD
109- 131 (31.60/17.00) RQAIGrVTAPS..TFKPPPRVtVTD
---------------------------------------------------------------------------
|