<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30823
Description |
Uncharacterized protein |
Sequence | MQQQQVLPFNLEQAEHNIRNLAELIRGAESLLRTKIQQEGSTSLAVQQLQTSIVAAKEKYRQVLTMHSNIKKYVSTQEKRNSEKRSTLSKGELEKLSANVLSRKEYENRNYQGFEKYPTAFSSREKFALTKEQWNQYGLRAVVPCELDWKQFPPMLMGKVGEMLSFGIVLKETKTGFHFPYSVRIFGVDEHVVYWSWSKYHIFRLISERAQAALCYYMEKAMYSNQPIEKALDTLLLWIKSHDTWEDWKLRFDMARSSFLPPCVRSFQNPLKSSARYPQTCVYTKHRKLDSFIGTHS |
Length | 297 |
Position | Tail |
Organism | Galdieria sulphuraria (Red alga) |
Kingdom | Rhodophyta |
Lineage | Eukaryota> Rhodophyta> Bangiophyceae> Cyanidiales> Cyanidiaceae> Galdieria.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.572 |
Instability index | 41.04 |
Isoelectric point | 9.47 |
Molecular weight | 34831.55 |
Publications | PubMed=23471408
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30823
No repeats found
|