<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30823
| Description |
Uncharacterized protein |
| Sequence | MQQQQVLPFNLEQAEHNIRNLAELIRGAESLLRTKIQQEGSTSLAVQQLQTSIVAAKEKYRQVLTMHSNIKKYVSTQEKRNSEKRSTLSKGELEKLSANVLSRKEYENRNYQGFEKYPTAFSSREKFALTKEQWNQYGLRAVVPCELDWKQFPPMLMGKVGEMLSFGIVLKETKTGFHFPYSVRIFGVDEHVVYWSWSKYHIFRLISERAQAALCYYMEKAMYSNQPIEKALDTLLLWIKSHDTWEDWKLRFDMARSSFLPPCVRSFQNPLKSSARYPQTCVYTKHRKLDSFIGTHS |
| Length | 297 |
| Position | Tail |
| Organism | Galdieria sulphuraria (Red alga) |
| Kingdom | Rhodophyta |
| Lineage | Eukaryota> Rhodophyta> Bangiophyceae> Cyanidiales> Cyanidiaceae> Galdieria.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.572 |
| Instability index | 41.04 |
| Isoelectric point | 9.47 |
| Molecular weight | 34831.55 |
| Publications | PubMed=23471408
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30823
No repeats found
|