<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30822

Description Uncharacterized protein
SequenceMARRARYTEKVDDSAGRPQYALEPPLIATRQPQQKDKDGNLAKDKKGKGLPRKVLDFSPWHGQHPEDILNENVVKTGYYDKAPGVNSTESNSAKPMIWPNLSQKNNMGLQTLSYLFSSVMEKRQQQGKVAAAPSFRPPPRITVPDTKREAWLRDLASNEVPLRKQSRAIPHGIKGKALMEQCVAKNVPIPRAIWLAKCVGANELRQFRRKGVSGAAAASKESQWIREWTVSIEQFLEGIVAMCGQPGWQSKMDYAVKMATSFYAERILERDHYLDWIVSSFAQAKMERLPIWIILVQHYWRDITSFGRRGRQLAEAVLERLHEITMENSRANDLLGDRLKKLVVVMAITNRDCLILPRTWTTYKYLLTPKTPGYNANLEMPARNIAKRNDRLSLRTPRNTCCALLRLYTVLDTVGFDIDAEKLTAVCTASVPSISKLVPALMSWSASVYRTSMHRTLLIAKIIAHLNSQGHDTDGIILEFLKSAKDTSLRIGDVHAVVVELVRTHCFSIGRLLQWLIVSGVISGGEGTSLATGLLSALPVDALPPNLVNARQMLMRRLGQVVDESTAMNRLLAGVDLSTGTARSPFDDSFAGIEALSGSTKLQFAQLIMSRARILAKDGGLSPQCFCTLRDILQHCNHPVALIDLTQAALNTNDAALLATVTDTISMHAMTLATLGRLQLLLDSLLEQYRHLRSQQPLDRSFILALVFLMRRFPEKASFVKLLENDLLICDQRISLAACSPASDNLVSMQASNLESHADIDAVFASGNTMDEQLMHRVFTRIAKCAGAAPTAQASNPSKVCGWLNQLRAIDIGGFELLARHYIRACLKNAEDTNVPAQVLCALVASGCIQLDTVADLALEAKTTLAACIAIRLIVSRTLANENLHPAEDYRFRLIQARYVAEHASKVITLAAGASEDPNCPVDDVGMINLVLDYALSCCELAVSTLIKVPLSPTYLSNCGRMTQNIFGLAHPVGEQNVDMVAKSIVALADPLSIVQCSALLKFYTRIGIFKDEDGGAALQQAILGAIQDGCEVWPQLLESAGQETIRGIYQWAKDQVLTSALRFDGAASLDVDGMQKILQILNVAHSAAKDGDVGLILSGITEKLRGLDGQFSMEHGDKVQDSKHHVQSLDILLHLAVLYSTSSDVNNDSLQQNRCNLLAALCSLLVNPKMQSHQEKLEYIHDVASRIADDLPEHALAGLAKNVTAGVARDPRLASILGTTQPPDSWLAAVSYLQPQPQISQQQRVLMKQAQVQGQAGRIPQLPVQQQQQASLLKMPAKRDERPTRSVPFPLRSWEIIPDAAVSMGENDTSLSLSLFGARKC
Length1322
PositionKinase
OrganismDothistroma septosporum (strain NZE10 / CBS 128990) (Red band needle blight fungus) (Mycosphaerella pini)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Dothistroma.
Aromaticity0.06
Grand average of hydropathy-0.086
Instability index42.11
Isoelectric point8.59
Molecular weight145415.08
Publications
PubMed=23209441
PubMed=23236275

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30822
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     120.93|      40|     345|     461|     506|       1
---------------------------------------------------------------------------
   26-   44 (23.89/ 7.16)	LIATRQPQQKDKDGNL......AKD.....................
  462-  506 (65.74/66.02)	IIAHLNSQGHDTDGIILEFLKSAKDTslrigDVHA.VVVELVRTHC
  823-  848 (31.31/19.37)	...............IRACLKNAEDT.....NVPAqVLCALVASGC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     262.84|      90|     521|     534|     751|       2
---------------------------------------------------------------------------
  654-  751 (124.41/305.17)	DAAllATVTDTISMHAmtLATLGR...LQLLLDSLLEQYrhLRSQQPLDrSFILALVFLMRRfPEKASFVKLLENDLLICDQ..RI.SLAACSPASDNLVSMQA
 1183- 1278 (138.44/62.20)	DVA..SRIADDLPEHA..LAGLAKnvtAGVARDPRLASI..LGTTQPPD.SWLAAVSYLQPQ.PQISQQQRVLMKQAQVQGQagRIpQLPVQQQQQASLLKMPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     202.93|      57|     520|     534|     590|       4
---------------------------------------------------------------------------
  534-  590 (94.56/50.83)	LLSALPVDALPPNLVNARQMLMRRLGQVVDESTAMNRLL..AGVDLSTGTAR.SPFDDSF
 1024- 1056 (28.78/10.88)	........................LGAIQDGCEVWPQLLesAGQETIRGIYQ.WAKDQ..
 1058- 1112 (79.59/41.73)	LTSALRFDGAASLDVDGMQKILQILN..VAHSAAKDGDV...GLILSGITEKlRGLDGQF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.11|      19|     438|     411|     429|       7
---------------------------------------------------------------------------
  411-  429 (32.88/23.08)	LDTVG.FDIDAEKLTAVCTA
  851-  870 (26.23/16.81)	LDTVAdLALEAKTTLAACIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.89|      23|     345|     238|     274|       8
---------------------------------------------------------------------------
  242-  272 (40.08/56.74)	MCGQPGW........QSkmdyavkmATSF......YAERILERDH
  286-  322 (29.82/ 8.93)	MERLPIWiilvqhywRD........ITSFgrrgrqLAEAVLERLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.31|      15|      17|     958|     972|      10
---------------------------------------------------------------------------
  958-  972 (29.53/21.60)	NCGRMTQNIFGLAHP
  977-  991 (24.78/16.83)	NVDMVAKSIVALADP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30822 with Med12 domain of Kingdom Fungi
Unable to open file!