Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSAQADQQGVTDTMQQSDNATSAEKTSEEPKTYRQIAAEHIDTLNEINHQIPKLLKYFATALSQLTNDPIPFQHDAMQCEPGTLEARKEAFRINALFCGTSCEIIRQELVKQINALERYKVIPKSHPKFAVTQSQARKGKEEESEVVDPEKDVKNGGYGDFDVGVLNARASSGQVGAEDVLDRARAILQELQKRTGGATSADDMVIDE |
Length | 208 |
Position | Head |
Organism | Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) (Southern corn leaf blight fungus) (Bipolaris maydis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.650 |
Instability index | 34.85 |
Isoelectric point | 4.97 |
Molecular weight | 22966.33 |
Publications | PubMed=23236275 PubMed=23357949 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30818 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 98.84| 30| 69| 34| 64| 1 --------------------------------------------------------------------------- 34- 64 (47.00/38.08) RQIAAEHIDTLnEINHQIPKLLKYFATALSQ 106- 135 (51.84/36.86) RQELVKQINAL.ERYKVIPKSHPKFAVTQSQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GGYGDFDVGVLNARAS 2) QVGAEDVLDRARAILQELQKRTGG | 156 174 | 171 197 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab