<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30814
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDDVLNEQFGRVERALTTLVDSIAAYNPATQAAIDLVAADDQLSDGLDQLAKHQANHGRIQTLRAEADALEAQLRDSVKKLAELRRELFNTPATTFSPESRAVPFDELLQYAANISRYTVPPTYRERVPTTDKDDDDVGSSGALTNGMSTPAIVPDAVDLPNDSSEAPKAGEDADGAVPDITAEEEEWLRKLKASNLAWYPWPSTEKIRNGILYRLSYWREKGNDLDQFDIPAYLEEQRKKALGNEASLEETPAEPTEEQPHREAARPTRPLSAFTGLDDMDEM |
| Length | 284 |
| Position | Middle |
| Organism | Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) (Southern corn leaf blight fungus) (Bipolaris maydis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.697 |
| Instability index | 41.85 |
| Isoelectric point | 4.43 |
| Molecular weight | 31514.32 |
| Publications | PubMed=23236275
PubMed=23357949
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30814
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.82| 22| 23| 135| 156| 1
---------------------------------------------------------------------------
132- 155 (34.92/21.12) DkdDDDVGSSGALTNGMSTPAIVP
156- 179 (34.91/21.12) DavDLPNDSSEAPKAGEDADGAVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.73| 24| 24| 81| 104| 2
---------------------------------------------------------------------------
80- 103 (38.88/21.57) KLAELRRELFNTPATTFSPESRA.V
104- 128 (36.85/20.13) PFDELLQYAANISRYTVPPTYRErV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.93| 19| 19| 220| 238| 3
---------------------------------------------------------------------------
193- 221 (23.95/10.32) KASNLAWYPWPStekirngilYrLSYWRE
222- 240 (33.98/17.03) KGNDLDQFDIPA.........Y.LEEQRK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.74| 24| 28| 21| 45| 4
---------------------------------------------------------------------------
21- 45 (34.72/26.80) DSIAAYNpATQAAIDLVAAD.D....QLSD
48- 76 (32.02/19.01) DQLAKHQ.ANHGRIQTLRAEaDaleaQLRD
---------------------------------------------------------------------------
|