Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDDVLNEQFGRVERALTTLVDSIAAYNPATQAAIDLVAADDQLSDGLDQLAKHQANHGRIQTLRAEADALEAQLRDSVKKLAELRRELFNTPATTFSPESRAVPFDELLQYAANISRYTVPPTYRERVPTTDKDDDDVGSSGALTNGMSTPAIVPDAVDLPNDSSEAPKAGEDADGAVPDITAEEEEWLRKLKASNLAWYPWPSTEKIRNGILYRLSYWREKGNDLDQFDIPAYLEEQRKKALGNEASLEETPAEPTEEQPHREAARPTRPLSAFTGLDDMDEM |
Length | 284 |
Position | Middle |
Organism | Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) (Southern corn leaf blight fungus) (Bipolaris maydis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.697 |
Instability index | 41.85 |
Isoelectric point | 4.43 |
Molecular weight | 31514.32 |
Publications | PubMed=23236275 PubMed=23357949 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30814 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.82| 22| 23| 135| 156| 1 --------------------------------------------------------------------------- 132- 155 (34.92/21.12) DkdDDDVGSSGALTNGMSTPAIVP 156- 179 (34.91/21.12) DavDLPNDSSEAPKAGEDADGAVP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.73| 24| 24| 81| 104| 2 --------------------------------------------------------------------------- 80- 103 (38.88/21.57) KLAELRRELFNTPATTFSPESRA.V 104- 128 (36.85/20.13) PFDELLQYAANISRYTVPPTYRErV --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.93| 19| 19| 220| 238| 3 --------------------------------------------------------------------------- 193- 221 (23.95/10.32) KASNLAWYPWPStekirngilYrLSYWRE 222- 240 (33.98/17.03) KGNDLDQFDIPA.........Y.LEEQRK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 66.74| 24| 28| 21| 45| 4 --------------------------------------------------------------------------- 21- 45 (34.72/26.80) DSIAAYNpATQAAIDLVAAD.D....QLSD 48- 76 (32.02/19.01) DQLAKHQ.ANHGRIQTLRAEaDaleaQLRD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EQPHREAARPTRPLSAFTGL 2) FDIPAYLEEQRKKAL 3) IRNGILYRLSYWREK 4) LQYAANI 5) SLEET | 259 229 208 109 248 | 278 243 222 115 252 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab