<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30810
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MPPPLPPPDEQEFDQPQLISGLPTPDLHAGNNLFWYFTSSPWFDSECINIDVYLNLRQNDPAVAEKIMNDPKLWQQRLDDQPEGTQYVIAGEGQGEGHPWLLQRQHKVRVTENDKERVENFVEGNWYTHGTKMLMAPSLLDIVQSRMLTVSTRMQQMAELSKNMTHWTPATGYSYFPPSYETAKATTTASRVGSPTLAPTDAEAPGSQSQGAGVAAQSTDSAASATDFSDALFMHSLNLTNAYGDEYMDENPLKGEPGAFVFEGTKTAVTARNKAQEQQANQVVQPVPAAPTELKIDTTTPSVAPSAVATPKAVATPGAMEGHSRKSSVAPGSKKKKDRRKSQAGLASPTTPSVPQTG |
Length | 358 |
Position | Head |
Organism | Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) (Southern corn leaf blight fungus) (Bipolaris maydis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.624 |
Instability index | 49.24 |
Isoelectric point | 5.24 |
Molecular weight | 38841.82 |
Publications | PubMed=23236275
PubMed=23357949
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30810
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.43| 15| 16| 190| 204| 3
---------------------------------------------------------------------------
190- 204 (25.15/13.75) SRVGSPTLA..PTDAEA
207- 223 (17.28/ 7.18) SQSQGAGVAaqSTDSAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.29| 17| 20| 120| 136| 5
---------------------------------------------------------------------------
120- 136 (33.25/25.01) NFVEGNWYTHGTKM.LMA
141- 158 (25.04/17.15) DIVQSRMLTVSTRMqQMA
---------------------------------------------------------------------------
|