<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30794

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMSDHSAKRQRLDSIGRFSPASPPFDVAAKASGQTTKTLPHPRTPTSPPYSSMNSQSNGGFSTTNTTTSSDRSPQSSVLMAHSLSQSAASASSLHPFPTPASTAGFLSSANVDSDGDATMEESADDDTLRSRCHRLSNHNRQAQSPYTPDGRLKAAQGISGSQLFKLNTDRIEKSRPHASQNLIRLYRLEPLASSVARNDPVTGEKINKLRKSYEGHIKQMQIAGKPKATKMDGVFRDLLMLPEEIWLPNHVQNREADKTALMPDGTGLTPDFSQLLDGAFAGMGPGPLPNADAAKYKAYLGTDDTVKPKAQDAPPQRTTPYTSSAPTPNNHINRGLVRPERSGSKRAYTDAAFQGYGEGFGDDYADSTGGEDTPGGSLANKRRKLQFERTSHSVEVGGARR
Length401
PositionHead
OrganismCochliobolus sativus (strain ND90Pr / ATCC 201652) (Common root rot and spot blotch fungus) (Bipolaris sorokiniana)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris.
Aromaticity0.06
Grand average of hydropathy-0.826
Instability index53.21
Isoelectric point9.31
Molecular weight43155.18
Publications
PubMed=23236275
PubMed=23357949

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30794
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.70|      19|      23|      19|      37|       1
---------------------------------------------------------------------------
   19-   37 (33.62/16.10)	PASPPF.DVAAKASGQTTKT
   44-   63 (32.08/15.07)	PTSPPYsSMNSQSNGGFSTT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     242.72|      76|     248|      65|     144|       2
---------------------------------------------------------------------------
   65-  144 (110.00/71.40)	TTTSSDRSPQSSVLMAHSLSQSAASASSlHPFpTPASTAGFlSSANVDSDGDATMEESADDDTLRSRCHRLsNHNRQAQS
  318-  393 (132.73/70.13)	TTPYTSSAPTPNNHINRGLVRPERSGSK.RAY.TDAAFQGY.GEGFGDDYADSTGGEDTPGGSLANKRRKL.QFERTSHS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.68|      14|      21|     162|     182|       3
---------------------------------------------------------------------------
  151-  167 (17.98/20.60)	RLKAAQGIsgsQLFKLN
  175-  189 (20.70/ 6.09)	RPHASQNL..iRLYRLE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30794 with Med19 domain of Kingdom Fungi
Unable to open file!