<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30786
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAEPQRPGQVEDEDIVLSFFPDPPPFYKHFTPENLARLQEIEKDAGLHENNDDDPSSSAAPGTKLSAEQILALPTELRYLIPPEPPADDAEFHVFDTVAKAKGTDVFMKNMEYIADQLKMQGVFQDWQYEQLYPSDPSSTTSSQQLPTSSTITTSNSVSMDRQNYLFRFLRSILLSYISLLGIVASDPVSEKKDEKLKDIMTMVANMHALINEYRPHQARQTLIERMEEQVRRKRAEVEGVRKMGEKVRQVLAGLGAVDGEDKDGVRDAWGEGSAGVGKEQVRKVEAQKGAWEALEEVLG |
| Length | 300 |
| Position | Middle |
| Organism | Cochliobolus sativus (strain ND90Pr / ATCC 201652) (Common root rot and spot blotch fungus) (Bipolaris sorokiniana) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.590 |
| Instability index | 45.69 |
| Isoelectric point | 4.80 |
| Molecular weight | 33642.41 |
| Publications | PubMed=23236275
PubMed=23357949
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30786
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.30| 15| 15| 227| 241| 1
---------------------------------------------------------------------------
227- 241 (24.47/16.76) MEEQVRRKRAEVEGV
244- 258 (22.74/15.07) MGEKVRQVLAGLGAV
260- 273 (19.09/11.50) GEDKDGVRDAWGEG.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.94| 31| 80| 26| 57| 2
---------------------------------------------------------------------------
26- 57 (51.30/34.63) FYKH..FTPENLaRLQEIEKDAGLHENNDDDPSS
107- 139 (53.63/32.09) FMKNmeYIADQL.KMQGVFQDWQYEQLYPSDPSS
---------------------------------------------------------------------------
|