Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MAEPQRPGQVEDEDIVLSFFPDPPPFYKHFTPENLARLQEIEKDAGLHENNDDDPSSSAAPGTKLSAEQILALPTELRYLIPPEPPADDAEFHVFDTVAKAKGTDVFMKNMEYIADQLKMQGVFQDWQYEQLYPSDPSSTTSSQQLPTSSTITTSNSVSMDRQNYLFRFLRSILLSYISLLGIVASDPVSEKKDEKLKDIMTMVANMHALINEYRPHQARQTLIERMEEQVRRKRAEVEGVRKMGEKVRQVLAGLGAVDGEDKDGVRDAWGEGSAGVGKEQVRKVEAQKGAWEALEEVLG |
Length | 300 |
Position | Middle |
Organism | Cochliobolus sativus (strain ND90Pr / ATCC 201652) (Common root rot and spot blotch fungus) (Bipolaris sorokiniana) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.590 |
Instability index | 45.69 |
Isoelectric point | 4.80 |
Molecular weight | 33642.41 |
Publications | PubMed=23236275 PubMed=23357949 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30786 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 66.30| 15| 15| 227| 241| 1 --------------------------------------------------------------------------- 227- 241 (24.47/16.76) MEEQVRRKRAEVEGV 244- 258 (22.74/15.07) MGEKVRQVLAGLGAV 260- 273 (19.09/11.50) GEDKDGVRDAWGEG. --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 104.94| 31| 80| 26| 57| 2 --------------------------------------------------------------------------- 26- 57 (51.30/34.63) FYKH..FTPENLaRLQEIEKDAGLHENNDDDPSS 107- 139 (53.63/32.09) FMKNmeYIADQL.KMQGVFQDWQYEQLYPSDPSS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LALPTELRYLIP 2) MAEPQRPGQVEDEDIVLSFFPDPPPFYKHFTPENLARLQEIEKDAG | 71 1 | 82 46 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab