<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30762
Description |
Uncharacterized protein |
Sequence | MADRLTQLQDAIDNQQTLMYAAINYITTRHPYAEIPGQPSQAPQLAKSSAPDSAVPQSAVSSQIPNGEPAKQQPNGAAPSTQIASDALEAPGSPPPEERDTFNAALHELARDLVLQEQQIELLINSLPGLGNSEASQMRRMRELEAALREMGSERAIAEQEKERMVDALGQMLTQVQRVP |
Length | 180 |
Position | Middle |
Organism | Baudoinia panamericana (strain UAMH 10762) (Angels' share fungus) (Baudoinia compniacensis (strain UAMH 10762)) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Teratosphaeriaceae> Baudoinia.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.575 |
Instability index | 62.58 |
Isoelectric point | 4.63 |
Molecular weight | 19548.64 |
Publications | PubMed=23236275
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30762
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 114.48| 37| 39| 91| 127| 1
---------------------------------------------------------------------------
91- 127 (63.24/33.32) PG...SPPPEER..DTFNAALHELARDLVLQEQQIELLINSL
128- 169 (51.24/25.93) PGlgnSEASQMRrmRELEAALREMGSERAIAEQEKERMVDAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.39| 21| 37| 26| 46| 2
---------------------------------------------------------------------------
26- 46 (37.66/17.40) ITTRHPYAEIPGQPSQAPQLA
64- 84 (36.74/16.82) IPNGEPAKQQPNGAAPSTQIA
---------------------------------------------------------------------------
|