Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MALSNDQLRAFDDLRQRLSQLSIFIETRKANLRNSDPLPSWPDLQGDHDHIVRNLSEVQETLSKHRELFTSAHAYPLPTFPGRTKEGTLSAVLRKKLETRGEDWIAEHLKFGTETSGQANGSVDGTTTAHPLNTSEAKQLWGEASQSHRDMLGDFLQGGVFDDDYTIAEREAGIESVVTGLRRKLNDEDESDEEDDDEGGDEDEKMEDVLPAKPASTVEPSKGNTVQPLRLETLLRFMTTGQLPPDR |
Length | 247 |
Position | Head |
Organism | Baudoinia panamericana (strain UAMH 10762) (Angels' share fungus) (Baudoinia compniacensis (strain UAMH 10762)) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Teratosphaeriaceae> Baudoinia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.832 |
Instability index | 45.97 |
Isoelectric point | 4.69 |
Molecular weight | 27597.00 |
Publications | PubMed=23236275 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30757 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 159.42| 49| 80| 114| 164| 1 --------------------------------------------------------------------------- 114- 164 (79.16/54.86) ETSGQANGSVDGTTTAHPLNTSEAKQlwGEASQSHR.DMLGDFLQGGVFDDD 197- 246 (80.26/48.67) DEGGDEDEKMEDVLPAKPASTVEPSK..GNTVQPLRlETLLRFMTTGQLPPD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 102.55| 32| 41| 6| 42| 3 --------------------------------------------------------------------------- 6- 42 (50.44/35.87) DQL.RAFDDLRQRLSQLSIFIETRKANlrnsdPLPSWP 49- 81 (52.11/27.48) DHIvRNLSEVQETLSKHRELFTSAHAY.....PLPTFP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DEKMEDVLPAKP 2) KGNTVQPLRLETLLRFMTTGQLP | 203 222 | 214 244 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab