<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30756
| Description |
Uncharacterized protein |
| Sequence | MAANYWDSTQAKYWTFTKPELSELRHQLTQHHQPTVSKFHLPDRRHLSIYMQTNLIKLARRLNLRQQALATAQIYIKRFYLRVEIRRTNPYLIMATAIYLACKMEETPQHIRLMLGEAARQWPELGVTETSKIGECEFAVISTLQSRLICHHPYRALGELQGTFGLGTEEGTLAHNIVNDCFNTDLPLLYAPHVIAITAMFLAVVLRPAGQMGGSAAQSALAGFAGLKQAGPKLGKMVDWLAESEVDMEAVIDATQEMVSLYECWEGYSERACKEAITKFMREGK |
| Length | 285 |
| Position | Kinase |
| Organism | Baudoinia panamericana (strain UAMH 10762) (Angels' share fungus) (Baudoinia compniacensis (strain UAMH 10762)) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Teratosphaeriaceae> Baudoinia.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.165 |
| Instability index | 52.77 |
| Isoelectric point | 7.68 |
| Molecular weight | 32247.94 |
| Publications | PubMed=23236275
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30756
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.18| 18| 18| 9| 26| 1
---------------------------------------------------------------------------
9- 26 (33.76/23.43) TQAKYWTFTKPELSELRH
29- 46 (35.43/24.90) TQHHQPTVSKFHLPDRRH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.13| 15| 22| 61| 76| 2
---------------------------------------------------------------------------
61- 76 (21.26/20.16) RLNLRQQA....LATAqIYI
82- 100 (20.87/13.69) RVEIRRTNpyliMATA.IYL
---------------------------------------------------------------------------
|