<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30749
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MATDTPQDVSTESSPPAQPTPPTGSGSGSPSPPQSPSPSSSPDSEPLYGGYSRFEIELEFVQALANPYYLNHIASQKLLSQPAFVAYLDYLQYWTRPPYLKYLTYPGPTLRHLELLQEERFRQDIMSPDLVRWLVEEDMRAAVEWHRELGPGVQA |
| Length | 155 |
| Position | Middle |
| Organism | Claviceps purpurea (strain 20.1) (Ergot fungus) (Sphacelia segetum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Claviceps.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.588 |
| Instability index | 91.29 |
| Isoelectric point | 4.65 |
| Molecular weight | 17425.21 |
| Publications | PubMed=23468653
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30749
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.09| 14| 24| 6| 19| 1
---------------------------------------------------------------------------
6- 19 (27.66/11.93) PQDVSTESSPPAQP
33- 46 (28.43/12.44) PQSPSPSSSPDSEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.12| 16| 22| 77| 92| 2
---------------------------------------------------------------------------
77- 92 (27.80/16.03) KLLSQPA.FVAYLDYLQ
101- 117 (24.32/13.29) KYLTYPGpTLRHLELLQ
---------------------------------------------------------------------------
|