<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30748
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MATLGLDDDELKCVEQTVARLAQLSSSIQSIKGDIMKSNLLPHPSSFQASTQILQRNLQSVLESLNENSELFSHMTIRPSTNYPGRAQENILMQLLRKKLEPDVEELVMEGRETAQWATPGRISALQAIWTELREWTQGRIAEYVREEAGDVYTKEERSRGIKSVRTGLKRALDEDSEEEEGGGVDEEEDFDEDGDEDEDEDEKGEEVSCGPEPETLLWFATRGDFDVPRNVEYERKTGIRTGLEGVNIPPDEDV |
Length | 255 |
Position | Head |
Organism | Claviceps purpurea (strain 20.1) (Ergot fungus) (Sphacelia segetum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Claviceps.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.807 |
Instability index | 52.88 |
Isoelectric point | 4.33 |
Molecular weight | 28790.30 |
Publications | PubMed=23468653
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30748
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.81| 16| 17| 173| 189| 1
---------------------------------------------------------------------------
174- 189 (28.93/15.34) DEDSEEEEGGGVDEEE
200- 215 (28.87/11.09) DEDEKGEEVSCGPEPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 125.36| 31| 33| 56| 86| 2
---------------------------------------------------------------------------
28- 50 (31.56/17.59) ..IQSIKGDIMK.SNLLPH....PSS.F..QAS
56- 86 (54.22/34.57) RNLQSVLESLNENSELFSHMTIRPSTNY..PGR
94- 122 (39.58/23.60) QLLRKKLEP..DVEELV..MEGRETAQWatPGR
---------------------------------------------------------------------------
|