<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30745
Description |
Uncharacterized protein |
Sequence | MSYWSKFIARCILQRLERKRFNDFIRLVHSQHPLPSILVAELFLRPQPDNDVSPDPRIPPYIQALSQHGYVDAPSILRALYKYSSLHAQLNPVAQLGAMDAIDDEKGREDGASGKKPMRRWRSSSWLEEVMFYHVIKTMVEGTAFRDTRAALQLCHVMSKRMGLFTSVSTLAWGAFKT |
Length | 178 |
Position | Tail |
Organism | Claviceps purpurea (strain 20.1) (Ergot fungus) (Sphacelia segetum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Claviceps.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.283 |
Instability index | 50.55 |
Isoelectric point | 9.61 |
Molecular weight | 20422.40 |
Publications | PubMed=23468653
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30745
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.71| 22| 36| 20| 43| 1
---------------------------------------------------------------------------
20- 43 (32.14/29.81) RFNDFIRLVhSQH...PLPSILVAeLF
57- 81 (36.57/23.07) RIPPYIQAL.SQHgyvDAPSILRA.LY
---------------------------------------------------------------------------
|